PDB entry 2ong

View 2ong on RCSB PDB site
Description: Crystal Structure of of limonene synthase with 2-fluorogeranyl diphosphate (FGPP).
Class: lyase
Keywords: monoterpene synthase, monoterpene cyclase, crystal structure, geranyl diphosphate, 2 fluorogeranyl diphosphate, linalyl diphosphate, 2-fluorolinalyl diphosphate, LYASE
Deposited on 2007-01-23, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4S-limonene synthase
    Species: Mentha spicata [TaxId:29719]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40322 (0-542)
      • engineered (0)
    Domains in SCOPe 2.07: d2onga1, d2onga2
  • Chain 'B':
    Compound: 4S-limonene synthase
    Species: Mentha spicata [TaxId:29719]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40322 (0-542)
      • engineered (0)
    Domains in SCOPe 2.07: d2ongb1, d2ongb2
  • Heterogens: MN, FPG, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ongA (A:)
    mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl
    qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf
    dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg
    dlltriaysldiplhwrikrpnapvwiewyrkrpdmnpvvlelaildlnivqaqfqeelk
    esfrwwrntgfveklpfardrlvecyfwntgiieprqhasarimmgkvnalitviddiyd
    vygtleeleqftdlirrwdinsidqlpdymqlcflalnnfvddtsydvmkekgvnvipyl
    rqswvdladkymvearwfygghkpsleeylenswqsisgpcmlthiffrvtdsftketvd
    slykyhdlvrwssfvlrladdlgtsveevsrgdvpkslqcymsdynaseaearkhvkwli
    aevwkkmnaervskdspfgkdfigcavdlgrmaqlmyhngdghgtqhpiihqqmtrtlfe
    pfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ongB (B:)
    mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl
    qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf
    dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg
    dlltriaysldiplhwrikrpnapvwiewyrkrpdmnpvvlelaildlnivqaqfqeelk
    esfrwwrntgfveklpfardrlvecyfwntgiieprqhasarimmgkvnalitviddiyd
    vygtleeleqftdlirrwdinsidqlpdymqlcflalnnfvddtsydvmkekgvnvipyl
    rqswvdladkymvearwfygghkpsleeylenswqsisgpcmlthiffrvtdsftketvd
    slykyhdlvrwssfvlrladdlgtsveevsrgdvpkslqcymsdynaseaearkhvkwli
    aevwkkmnaervskdspfgkdfigcavdlgrmaqlmyhngdghgtqhpiihqqmtrtlfe
    pfa