PDB entry 2om5

View 2om5 on RCSB PDB site
Description: N-Terminal Fragment of Human TAX1
Class: cell adhesion
Keywords: x-ray crystallography; Ig-like C2-type; immunoglobulin superfamily; fibronectin; membrane protein, CELL ADHESION
Deposited on 2007-01-20, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.07 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2om5A (A:)
    tfgpvfedqplsvlfpeesteeqvllacrarasppatyrwkmngtemklepgsrhqlvgg
    nlvimnptkaqdagvyqclasnpvgtvvsreailrfgflqefskeerdpvkahegwgvml
    pcnppahypglsyrwllnefpnfiptdgrhfvsqttgnlyiartnasdlgnysclatshm
    dfstksvfskfaqlnlaaedtrlfapsikarfpaetyalvgqqvtlecfafgnpvprikw
    rkvdgslspqwttaeptlqipsvsfedegtyeceaenskgrdtvqgriivqaqpewlkvi
    sdteadigsnlrwgcaaagkprptvrwlrngeplasqnrvevlagdlrfsklsledsgmy
    qcvaenkhgtiyasaelavqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2om5A (A:)
    tfgpvfedqplsvlfpeesteeqvllacrarasppatyrwkmngtemklepgsrhqlvgg
    nlvimnptkaqdagvyqclasnpvgtvvsreailrfgflqefskeerdpvkahegwgvml
    pcnppahypglsyrwllnefpnfiptdgrhfvsqttgnlyiartnasdlgnysclatshm
    dfstksvfskfaqlnlaaedtrlfapsikarfpaetyalvgqqvtlecfafgnpvprikw
    rkvaeptlqipsvsfedegtyeceaenskgrdtvqgriivqaqpewlkvisdteadigsn
    lrwgcaaagkprptvrwlrngeplasqnrvevlagdlrfsklsledsgmyqcvaenkhgt
    iyasaelavqa