PDB entry 2olj

View 2olj on RCSB PDB site
Description: ABC Protein ArtP in complex with ADP/Mg2+
Class: hydrolase
Keywords: ABC Domain, ATPase, Hydrolase
Deposited on 2007-01-19, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid ABC transporter
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OLJ (Start-262)
    Domains in SCOPe 2.07: d2olja1, d2olja2
  • Chain 'B':
    Compound: Amino acid ABC transporter
    Species: Geobacillus Stearothermophilus [TaxId:1422]
    Gene: artP
    Database cross-references and differences (RAF-indexed):
    • PDB 2OLJ (Start-262)
    Domains in SCOPe 2.07: d2oljb1, d2oljb2
  • Heterogens: MG, ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oljA (A:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oljA (A:)
    lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
    iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
    elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
    mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
    vf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oljB (B:)
    mgsshhhhhhssglvprgshmlqmidvhqlkksfgslevlkginvhiregevvvvigpsg
    sgkstflrclnlledfdegeiiidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnn
    itlapmkvrkwprekaeakamelldkvglkdkahaypdslsggqaqrvaiaralamepki
    mlfdeptsaldpemvgevlsvmkqlanegmtmvvvthemgfarevgdrvlfmdggyiiee
    gkpedlfdrpqhertkaflskvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oljB (B:)
    lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
    iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
    elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
    mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
    vf