PDB entry 2old

View 2old on RCSB PDB site
Description: Bence Jones KWR Protein- Immunoglobulin Light Chain Dimer, P3(2)21 Crystal Form
Class: immune system
Keywords: Immunoglobulin Light Chain, IMMUNE SYSTEM
Deposited on 2007-01-19, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OLD (0-216)
    Domains in SCOPe 2.07: d2olda1, d2olda2
  • Chain 'B':
    Compound: Bence Jones KWR Protein - Immunoglobulin Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2OLD (0-216)
    Domains in SCOPe 2.07: d2oldb1, d2oldb2
  • Heterogens: PO4, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oldA (A:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oldB (B:)
    esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
    sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs