PDB entry 2ok1

View 2ok1 on RCSB PDB site
Description: Crystal structure of JNK3 bound to N-benzyl-4-(4-(3-chlorophenyl)-1H-pyrazol-3-yl)-1H-pyrrole-2-carboxamide
Class: transferase
Keywords: kinase inhibitor
Deposited on 2007-01-15, released 2007-02-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.246
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ok1a1
  • Heterogens: 33A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ok1A (A:)
    mgskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ok1A (A:)
    nqfysvevgdstftvlkryqnlkpigaqgivcaaydavldrnvaikklsrpfqnqthakr
    ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldherms
    yllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglavtryyrapevilgmgy
    kenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyven
    rpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqhpyin
    vwydpaeveapppderehtieewkeliykevmn