PDB entry 2oj9

View 2oj9 on RCSB PDB site
Description: Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
Class: transferase
Keywords: hormone/growth factor, igf-1r, kinase domain, transferase
Deposited on 2007-01-12, released 2007-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD221 antigen)
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2oj9a_
  • Heterogens: BMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oj9A (A:)
    mvsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeme
    nnpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsne
    qvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsf
    yyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj9A (A:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeppslsk
    miqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggk
    gllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggll
    dkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk