PDB entry 2oj9

View 2oj9 on RCSB PDB site
Description: Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
Class: transferase
Keywords: hormone/growth factor, igf-1r, kinase domain
Deposited on 2007-01-12, released 2007-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1998
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor 1 receptor precursor (EC 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD221 antigen)
    Species: HOMO SAPIENS
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2oj9a1
  • Heterogens: BMI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oj9A (A:)
    mvsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeme
    nnpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsne
    qvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsf
    yyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj9A (A:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeppslsk
    miqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggk
    gllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmeggll
    dkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk