PDB entry 2oj4

View 2oj4 on RCSB PDB site
Description: Crystal structure of RGS3 RGS domain
Class: signaling protein inhibitor
Keywords: protein; rgs domain, signaling protein inhibitor
Deposited on 2007-01-12, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 3
  Species: Homo sapiens [TaxId:9606]
  Gene: RGS3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49796 (0-126)
  Domains in SCOPe 2.08: d2oj4a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oj4A (A:)
  seealkwgeslekllvhkyglavfqaflrtefseenlefwlacedfkkvksqskmaskak
  kifaeyiaiqackevnldsytrehtkdnlqsvtrgcfdlaqkrifglmekdsyprflrsd
  lyldlin