PDB entry 2oj3

View 2oj3 on RCSB PDB site
Description: Hepatitis Delta Virus ribozyme precursor structure, with C75U mutation, bound to Tl+ and cobalt hexammine (Co(NH3)63+)
Class: Structural Protein/RNA
Keywords: Tl+ and cobalt hexammine compete for binding sites., Structural Protein/RNA COMPLEX
Deposited on 2007-01-12, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • conflict (30)
      • conflict (35)
    Domains in SCOPe 2.06: d2oj3a_
  • Chain 'B':
    Compound: HDV ribozyme
    Species: synthetic, synthetic
  • Heterogens: NCO, TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oj3A (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oj3A (A:)
    petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
    satnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

  • Chain 'B':
    No sequence available.