PDB entry 2oil

View 2oil on RCSB PDB site
Description: Crystal structure of human RAB25 in complex with GDP
Class: protein transport
Keywords: g-protein, rab, GDP, structural genomics, structural genomics consortium, sgc, protein transport
Deposited on 2007-01-11, released 2007-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-25
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB25, CATX8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2oila_
  • Heterogens: MG, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oilA (A:)
    mgsshhhhhhssglvprgsedynfvfkvvligesgvgktnllsrftrnefshdsrttigv
    efstrtvmlgtaavkaqiwdtagleryraitsayyrgavgallvfdltkhqtyavverwl
    kelydhaeativvmlvgnksdlsqarevpteearmfaenngllfletsaldstnvelafe
    tvlkeifakvskq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oilA (A:)
    edynfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavkaqiw
    dtagleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvmlvgnk
    sdlsqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvskq