PDB entry 2oii

View 2oii on RCSB PDB site
Description: Structure of EMILIN-1 C1q-like domain
Class: structural protein
Keywords: Emilin-1, C1q-like domain, homotrimeric protein complex, beta-sandwich, STRUCTURAL PROTEIN
Deposited on 2007-01-11, released 2008-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EMILIN1, EMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oiia_
  • Chain 'B':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EMILIN1, EMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oiib_
  • Chain 'C':
    Compound: emilin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: EMILIN1, EMI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oiic_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oiiA (A:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oiiA (A:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oiiB (B:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oiiB (B:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oiiC (C:)
    mrgshhhhhhgspvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagr
    yllsavltghrhekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfsli
    lplqagdtvcvdlvmgqlahseepltifsgallygdpeleha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oiiC (C:)
    pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
    ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
    llygdpeleha