PDB entry 2ogw

View 2ogw on RCSB PDB site
Description: Structure of ABC type zinc transporter from E. coli
Class: transport protein
Keywords: abc, zinc, transporter, TRANSPORT PROTEIN
Deposited on 2007-01-09, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.225
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-affinity zinc uptake system protein znuA precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39172
      • modified residue (84)
      • modified residue (88)
      • modified residue (114)
      • modified residue (141)
      • modified residue (165)
      • modified residue (274)
    Domains in SCOPe 2.07: d2ogwa_
  • Chain 'B':
    Compound: High-affinity zinc uptake system protein znuA precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39172
      • modified residue (84)
      • modified residue (88)
      • modified residue (114)
      • modified residue (141)
      • modified residue (165)
      • modified residue (274)
    Domains in SCOPe 2.07: d2ogwb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ogwA (A:)
    mlhkktllfaalsaalwggatqaadaavvaslkpvgfiasaiadgvtetevllpdgaseh
    dyslrpsdvkrlqnadlvvwvgpemeafmqkpvsklpgakqvtiaqledvkpllmksihg
    ddddhdhaeksdedhhhgdfnmhlwlspeiaratavaihgklvelmpqsrakldanlkdf
    eaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghftvnpeiqpgaqrlhe
    irtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtniklgktsyseflsqla
    nqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogwA (A:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmkdfnmhlwlspeiaratavaihgklvelmpq
    srakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghftvn
    peiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtniklg
    ktsyseflsqlanqyasclk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ogwB (B:)
    mlhkktllfaalsaalwggatqaadaavvaslkpvgfiasaiadgvtetevllpdgaseh
    dyslrpsdvkrlqnadlvvwvgpemeafmqkpvsklpgakqvtiaqledvkpllmksihg
    ddddhdhaeksdedhhhgdfnmhlwlspeiaratavaihgklvelmpqsrakldanlkdf
    eaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghftvnpeiqpgaqrlhe
    irtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtniklgktsyseflsqla
    nqyasclkgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogwB (B:)
    avvaslkpvgfiasaiadgvtetevllpdgasehdyslrpsdvkrlqnadlvvwvgpeme
    afmqkpvsklpgakqvtiaqledvkpllmkdfnmhlwlspeiaratavaihgklvelmpq
    srakldanlkdfeaqlastetqvgnelaplkgkgyfvfhdaygyfekqfgltplghftvn
    peiqpgaqrlheirtqlveqkatcvfaepqfrpavvesvargtsvrmgtldplgtniklg
    ktsyseflsqlanqyasclk