PDB entry 2ogt

View 2ogt on RCSB PDB site
Description: Crystal Structure of the Geobacillus Stearothermophilus Carboxylesterase EST55 at pH 6.8
Class: hydrolase
Keywords: carboxylesterase, alpha/beta hydrolase, hydrolase
Deposited on 2007-01-08, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable carboxylesterase Est50
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ogta_
  • Heterogens: IOD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ogtA (A:)
    mertvvetrygrlrgemnegvfvwkgipyakapvgerrflppeppdawdgvreatsfgpv
    vmqpsdpifsgllgrmseapsedglylniwspaadgkkrpvlfwihggaflfgsgsspwy
    dgtafakhgdvvvvtinyrmnvfgflhlgdsfgeayaqagnlgildqvaalrwvkeniaa
    fggdpdnitifgesagaasvgvllslpeasglfrramlqsgsgslllrspetamamteri
    ldkagirpgdrerllsipaeellraalslgpgvmygpvvdgrvlrrhpiealrygaasgi
    piligvtkdeynlftltdpswtklgekelldrinrevgpvpeeairyyketaepsaptwq
    twlrimtyrvfvegmlrtadaqaaqgadvymyrfdyetpvfggqlkachalelpfvfhnl
    hqpgvanfvgnrpereaianemhyawlsfartgdpngahlpeawpaytnerkaafvfsaa
    shveddpfgreraawqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogtA (A:)
    rtvvetrygrlrgemnegvfvwkgipyakapvgerrflppeppdawdgvreatsfgpvvm
    qpspsedglylniwspaadgkkrpvlfwihggaflfgsgsspwydgtafakhgdvvvvti
    nyrmnvfgflhlgdsfgeayaqagnlgildqvaalrwvkeniaafggdpdnitifgesag
    aasvgvllslpeasglfrramlqsgsgslllrspetamamterildkagirpgdrerlls
    ipaeellraalslgpgvmygpvvdgrvlrrhpiealrygaasgipiligvtkdeynlftl
    tdpswtklgekelldrinrevgpvpeeairyywqtwlrimtyrvfvegmlrtadaqaaqg
    advymyrfdyetpvchalelpfvfhnlhqpgvanfvgnrpereaianemhyawlsfartg
    dpngahlpeawpaytnerkaafvfsaashveddpfgreraawq