PDB entry 2ogs

View 2ogs on RCSB PDB site
Description: Crystal Structure of the GEOBACILLUS STEAROTHERMOPHILUS Carboxylesterase EST55 at pH 6.2
Class: hydrolase
Keywords: carboxylesterase, alpha/beta hydrolase
Deposited on 2007-01-08, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable carboxylesterase Est50
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GCC7
      • modified residue (407)
    Domains in SCOPe 2.06: d2ogsa_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ogsA (A:)
    mertvvetrygrlrgemnegvfvwkgipyakapvgerrflppeppdawdgvreatsfgpv
    vmqpsdpifsgllgrmseapsedglylniwspaadgkkrpvlfwihggaflfgsgsspwy
    dgtafakhgdvvvvtinyrmnvfgflhlgdsfgeayaqagnlgildqvaalrwvkeniaa
    fggdpdnitifgesagaasvgvllslpeasglfrramlqsgsgslllrspetamamteri
    ldkagirpgdrerllsipaeellraalslgpgvmygpvvdgrvlrrhpiealrygaasgi
    piligvtkdeynlftltdpswtklgekelldrinrevgpvpeeairyyketaepsaptwq
    twlrimtyrvfvegmlrtadaqaaqgadvymyrfdyetpvfggqlkaahalelpfvfhnl
    hqpgvanfvgnrpereaianemhyawlsfartgdpngahlpeawpaytnerkaafvfsaa
    shveddpfgreraawqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ogsA (A:)
    rtvvetrygrlrgemnegvfvwkgipyakapvgerrflppeppdawdgvreatsfgpvvm
    qpsseapsedglylniwspaadgkkrpvlfwihggaflfgsgsspwydgtafakhgdvvv
    vtinyrmnvfgflhlgdsfgeayaqagnlgildqvaalrwvkeniaafggdpdnitifge
    sagaasvgvllslpeasglfrramlqsgsgslllrspetamamterildkagirpgdrer
    llsipaeellraalslgpgvmygpvvdgrvlrrhpiealrygaasgipiligvtkdeynl
    ftltdpswtklgekelldrinrevgpvpeeairyyketaepsaptwqtwlrimtyrvfve
    gmlrtadaqaaqgadvymyrfdyetpvlkaahalelpfvfhnlhqpgvanfvgnrperea
    ianemhyawlsfartgdpngahlpeawpaytnerkaafvfsaashveddpfgreraawq