PDB entry 2ofy

View 2ofy on RCSB PDB site
Description: Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp.
Class: transcription
Keywords: transcription regulator, xre-family, structural genomics, psi, protein structure initiative, midwest center for structural genomics, mcsg, transcription
Deposited on 2007-01-04, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative XRE-family transcriptional regulator
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro04071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S9B8
      • modified residue (27)
      • modified residue (29)
    Domains in SCOPe 2.08: d2ofya1
  • Chain 'B':
    Compound: Putative XRE-family transcriptional regulator
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro04071
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S9B8
      • modified residue (27)
      • modified residue (29)
    Domains in SCOPe 2.08: d2ofyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ofyA (A:)
mvrvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpaffti
aavarvldlslddvaavvtfgpvsts

    Sequence, based on observed residues (ATOM records): (download) 
    >2ofyA (A:)
rvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaa
varvldlslddvaavvtfgpvs

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ofyB (B:)
mvrvpltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpaffti
aavarvldlslddvaavvtfgpvsts

    Sequence, based on observed residues (ATOM records): (download) 
    >2ofyB (B:)
pltaeelergqrlgellrsargdmsmvtvafdagisvetlrkietgriatpafftiaava
rvldlslddvaavvtfgpvs