PDB entry 2ofv

View 2ofv on RCSB PDB site
Description: crystal structure of aminoquinazoline 1 bound to Lck
Class: transferase
Keywords: Lck, Kinase domain
Deposited on 2007-01-04, released 2007-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-27, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.274
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: HOMO SAPIENS
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (11-End)
      • cloning artifact (5)
    Domains in SCOP 1.73: d2ofva1
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: HOMO SAPIENS
    Gene: LCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06239 (11-End)
      • cloning artifact (273)
    Domains in SCOP 1.73: d2ofvb1
  • Heterogens: 242, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ofvA (A:)
    tqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaf
    laeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldma
    aqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpik
    wtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdnc
    peelyqlmrlcwkerpedrptfdylrsvledfftate
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofvA (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqglaeanlmkqlqh
    qrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafiee
    rnyihrdlraanilvsdtlsckiadfglaikwtapeainygtftiksdvwsfgillteiv
    thgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvl
    edff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ofvB (B:)
    tqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaf
    laeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldma
    aqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpik
    wtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdnc
    peelyqlmrlcwkerpedrptfdylrsvledfftate
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ofvB (B:)
    pwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgaflaeanlmkqlq
    hqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafie
    ernyihrdlraanilvsdtlsckiadfglarliedpikwtapeainygtftiksdvwsfg
    illteivthgripypiqnlegyrmvrpdncpeelyqlmrlcwkerpedrptfdylrsvle
    dfft