PDB entry 2of4

View 2of4 on RCSB PDB site
Description: crystal structure of furanopyrimidine 1 bound to lck
Class: transferase
Keywords: lck, kinase domain
Deposited on 2007-01-02, released 2007-02-27
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.264
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: HOMO SAPIENS
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2of4a1
  • Heterogens: 979, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2of4A (A:)
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat