PDB entry 2of2

View 2of2 on RCSB PDB site
Description: crystal structure of furanopyrimidine 8 bound to lck
Class: transferase
Keywords: lck, kinase domain, TRANSFERASE
Deposited on 2007-01-02, released 2007-02-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.26
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2of2a_
  • Heterogens: 547, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2of2A (A:)
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat