PDB entry 2oed

View 2oed on RCSB PDB site
Description: GB3 solution structure obtained by refinement of X-ray structure with dipolar couplings
Class: immune system
Keywords: immune system, residual dipolar couplings
Deposited on 2006-12-29, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2oeda2, d2oeda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oedA (A:)
    mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte