PDB entry 2odb

View 2odb on RCSB PDB site
Description: The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6)
Class: protein binding
Keywords: small GTPase, CRIB, kinase, protein-protein complex, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING
Deposited on 2006-12-22, released 2007-01-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human Cell Division Cycle 42 (CDC42)
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2odba_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PAK 6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, SO4, GCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2odbA (A:)
smqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdta
gqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidl
rddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalep
pepkksrrcvll

    Sequence, based on observed residues (ATOM records): (download) 
    >2odbA (A:)
qtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagq
edydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrd
dpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

  • Chain 'B':
    No sequence available.