PDB entry 2ocy

View 2ocy on RCSB PDB site
Description: Complex of the guanine exchange factor Sec2p and the Rab GTPase Sec4p
Class: endocytosis/exocytosis
Keywords: Rab, GEF, guanine exchange factor, coiled-coil, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2006-12-21, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.25
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (3-End)
      • cloning artifact (0-2)
      • modified residue (101)
      • modified residue (144)
    Domains in SCOPe 2.06: d2ocya1, d2ocya2
  • Chain 'B':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (3-End)
      • cloning artifact (0-2)
      • modified residue (101)
      • modified residue (144)
    Domains in SCOPe 2.06: d2ocyb1, d2ocyb2
  • Chain 'C':
    Compound: Ras-related protein SEC4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SEC4, SRO6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07560 (0-End)
      • modified residue (3)
      • modified residue (76)
    Domains in SCOPe 2.06: d2ocyc1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ocyA (A:)
    smalstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddev
    krlrediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrl
    teqlrekdtlldtltlqlknlkkvmhsldnestv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocyA (A:)
    smalstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddev
    krlrediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrl
    teqlrekdtlldtltlqlknlkkvmhsld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ocyB (B:)
    smalstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddev
    krlrediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrl
    teqlrekdtlldtltlqlknlkkvmhsldnestv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocyB (B:)
    smalstqliesvdkqshleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddev
    krlrediakenelrtkaeeeadklnkevedltaslfdeannmvadarkekyaieilnkrl
    teqlrekdtlldtltlqlknlkkvmhsld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ocyC (C:)
    dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdta
    gqerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdm
    etrvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ocyC (C:)
    dsimkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdklqlwdtagqerfr
    tittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgdqgealakelg
    ipfiessanvneifftlakliqekids