PDB entry 2ocg

View 2ocg on RCSB PDB site
Description: Crystal structure of human valacyclovir hydrolase
Class: hydrolase
Keywords: alpha beta hydrolase fold, HYDROLASE
Deposited on 2006-12-20, released 2008-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.182
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Valacyclovir hydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: BPHL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ocga_
  • Heterogens: MN, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ocgA (A:)
    svtsakvavngvqlhyqqtgegdhavlllpgmlgsgetdfgpqlknlnkklftvvawdpr
    gyghsrppdrdfpadfferdakdavdlmkalkfkkvsllgwsdggitaliaaakypsyih
    kmviwganayvtdedsmiyegirdvskwsertrkplealygydyfartcekwvdgirqfk
    hlpdgnicrhllprvqcpalivhgekdplvprfhadfihkhvkgsrlhlmpegkhnlhlr
    fadefnklaedflq