PDB entry 2ocb

View 2ocb on RCSB PDB site
Description: Crystal structure of human RAB9B in complex with a GTP analogue
Class: transport protein
Keywords: G-PROTEIN, RAB, GTPASE, GTP ANALOGUE, Structural Genomics, Structural Genomics Consortium, SGC, TRANSPORT PROTEIN
Deposited on 2006-12-20, released 2007-01-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-9B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB9B, RAB9L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ocba_
  • Heterogens: MG, GNP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ocbA (A:)
gsgkslllkvillgdggvgksslmnryvtnkfdsqafhtigveflnrdlevdgrfvtlqi
wdtagqerfkslrtpfyrgadcclltfsvddrqsfenlgnwqkefiyyadvkdpehfpfv
vlgnkvdkedrqvtteeaqtwcmengdypyletsakddtnvtvafeeavrqvlaveeqle

    Sequence, based on observed residues (ATOM records): (download) 
    >2ocbA (A:)
gkslllkvillgdggvgksslmnryvtnkfdsqafhtigveflnrdlevdgrfvtlqiwd
tagqerfkslrtpfyrgadcclltfsvddrqsfenlgnwqkefiyyadvkdpehfpfvvl
gnkvdkedrqvtteeaqtwcmengdypyletsakddtnvtvafeeavrqvlav