PDB entry 2oai

View 2oai on RCSB PDB site
Description: The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
Class: toxin
Keywords: pfam03471, Xylella fastidiosa Temecula1, hemolysin, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TOXIN
Deposited on 2006-12-15, released 2007-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemolysin
    Species: Xylella fastidiosa [TaxId:183190]
    Gene: tlyC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87DZ3 (Start-93)
      • modified residue (11)
      • modified residue (52)
      • modified residue (86)
    Domains in SCOPe 2.01: d2oaia1
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oaiA (A:)
    snaentdedalmvtredgsflidgtlpieelrevlgaelpdgeennyhtlagmcisyfgr
    iphvgeyfdwagwrieivdldgaridklllqrln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oaiA (A:)
    edalmvtredgsflidgtlpieelrevlgannyhtlagmcisyfgriphvgeyfdwagwr
    ieivdldgaridklllqrln