PDB entry 2o9r

View 2o9r on RCSB PDB site
Description: beta-glucosidase B complexed with thiocellobiose
Class: Hydrolase
Keywords: beta-glucosidase, glycosyl hydrolase family 1, thiocellobiose inhibitor
Deposited on 2006-12-14, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase B
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22505 (7-451)
      • engineered (379-380)
    Domains in SCOPe 2.06: d2o9ra_
  • Heterogens: TCB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o9rA (A:)
    mhhhhhhntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdva
    cdhfhhfkedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglip
    mltlyhwdlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgy
    gtgehapghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserped
    vaaairrdgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflgin
    yytrsiirstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilite
    ngaamrdelvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgysk
    rfgivhinyetqertpkqsalwfkqmmakngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o9rA (A:)
    ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
    kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
    dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
    ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
    dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
    rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
    elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
    nyetqertpkqsalwfkqmmakngf