PDB entry 2o9p

View 2o9p on RCSB PDB site
Description: beta-glucosidase B from Paenibacillus polymyxa
Class: Hydrolase
Keywords: beta-glucosidase, family 1 glycoside hydrolase
Deposited on 2006-12-14, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase B
    Species: Paenibacillus polymyxa [TaxId:1406]
    Gene: bglB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22505 (Start-453)
      • engineered (381-382)
    Domains in SCOPe 2.06: d2o9pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o9pA (A:)
    mhhhhhhsentfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgd
    vacdhfhhfkedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielagl
    ipmltlyhwdlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasil
    gygtgehapghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserp
    edvaaairrdgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflg
    inyytrsiirstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpili
    tengaamrdelvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgy
    skrfgivhinyetqertpkqsalwfkqmmakngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o9pA (A:)
    ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
    kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
    dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
    ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
    dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
    rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
    elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
    nyetqertpkqsalwfkqmmakngf