PDB entry 2o9o

View 2o9o on RCSB PDB site
Description: Crystal Structure of the buffalo Secretory Signalling Glycoprotein at 2.8 A resolution
Class: signaling protein
Keywords: SPB-40, TIM barrel, SIGNALING PROTEIN
Deposited on 2006-12-14, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitinase-3-like protein 1
    Species: Bubalus bubalis [TaxId:89462]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o9oa1, d2o9oa2
  • Heterogens: NAG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o9oA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v