PDB entry 2o98

View 2o98 on RCSB PDB site
Description: Structure of the 14-3-3 / H+-ATPase plant complex
Class: protein binding
Keywords: H, ATPase, 14-3-3, plasma membrane, electrochemical proton gradient, cell turgor, regulation, PROTEIN BINDING
Deposited on 2006-12-13, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3-like protein c
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o98a_
  • Chain 'B':
    Compound: 14-3-3-like protein c
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o98b_
  • Chain 'P':
    Compound: plasma membrane h+ ATPase
    Species: Nicotiana plumbaginifolia [TaxId:4092]
    Gene: pma2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40409 (0-51)
      • engineered (50-51)
  • Chain 'Q':
    Compound: plasma membrane h+ ATPase
    Species: Nicotiana plumbaginifolia [TaxId:4092]
    Gene: pma2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q40409 (Start-51)
      • engineered (50-51)
  • Heterogens: SO4, FSC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o98A (A:)
    mavaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvig
    arraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaas
    gdskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlgla
    lnfsvfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd
    mq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o98A (A:)
    avaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknviga
    rraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasg
    dskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglal
    nfsvfyyeilnspdracnlakqafdeaiaelsykdstlimqllrdnltlwtsdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o98B (B:)
    mavaptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvig
    arraswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaas
    gdskvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlgla
    lnfsvfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd
    mq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o98B (B:)
    aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
    aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
    kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
    svfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.