PDB entry 2o96

View 2o96 on RCSB PDB site
Description: Crystal Structure of the Metal-Free Dimeric Human Mov34 MPN domain (residues 1-177)
Class: unknown function
Keywords: PSMD7, 26S Proteasome subunit, Mov34, Jab1/MPN, metal-free dimer, UNKNOWN FUNCTION
Deposited on 2006-12-13, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMD7, MOV34L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o96a_
  • Chain 'B':
    Compound: 26S proteasome non-ATPase regulatory subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMD7, MOV34L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o96b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o96A (A:)
    gmpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfd
    eddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpns
    vlviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeaeevgvehllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o96A (A:)
    pelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfded
    dkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsvl
    viidvkpkdlpteayisveeptsktfehvtseigaeea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o96B (B:)
    gmpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfd
    eddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpns
    vlviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeaeevgvehllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o96B (B:)
    mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
    ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
    lviidvkpkdglpteayisveeptsktfehvtseigaeeae