PDB entry 2o95

View 2o95 on RCSB PDB site
Description: Crystal Structure of the Metal-Free Dimeric Human Mov34 MPN domain (residues 1-186)
Class: unknown function
Keywords: PSMD7, 26S Proteasome, Mov34, Jab1/MPN, metal-free dimer, UNKNOWN FUNCTION
Deposited on 2006-12-13, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMD7, MOV34L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o95a_
  • Chain 'B':
    Compound: 26S proteasome non-ATPase regulatory subunit 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMD7, MOV34L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o95b_
  • Heterogens: SO4, 12P, ETE, PG4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o95A (A:)
    gmpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfd
    eddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpns
    vlviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeaeevgvehllrdi
    kdttvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o95A (A:)
    mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
    ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
    lviidvkpkdglpteayisveevhptsktfehvtseigaeeaeevgvehllrdikdttv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o95B (B:)
    gmpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfd
    eddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpns
    vlviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeaeevgvehllrdi
    kdttvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o95B (B:)
    mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
    ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
    lviidvkpkdglpteayisveevhptsktfehvtseigaeeaeevgvehllrdikd