PDB entry 2o8v

View 2o8v on RCSB PDB site
Description: PAPS reductase in a covalent complex with thioredoxin C35A
Class: oxidoreductase
Keywords: Disulfide crosslinked complex, OXIDOREDUCTASE
Deposited on 2006-12-12, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.297
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoadenosine phosphosulfate reductase
    Species: Escherichia coli [TaxId:562]
    Gene: cysH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1R4F8 (20-127)
      • engineered (54)
    Domains in SCOPe 2.06: d2o8vb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2o8vB (B:)
mgsshhhhhhssglvprgshsdkiihltddsfdtdvlkadgailvdfwaewcgpakmiap
ildeiadeyqgkltvaklnidqnpgtapkygirgiptlllfkngevaatkvgalskgqlk
efldanla

    Sequence, based on observed residues (ATOM records): (download) 
    >2o8vB (B:)
sdkiihltddsfdtdvlkadgailvdfwaewcgpakmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla