PDB entry 2o87

View 2o87 on RCSB PDB site
Description: S. aureus thioredoxin P31S mutant
Class: electron transport
Keywords: thioredoxin, redox enzyme, oxidoreductase, ELECTRON TRANSPORT
Deposited on 2006-12-12, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K6 (3-105)
      • engineered (32)
    Domains in SCOPe 2.07: d2o87a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o87A (A:)
    gshaivkvtdadfdskvesgvqlvdfwatwcgsckmiapvleelaadyegkadilkldvd
    enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o87A (A:)
    aivkvtdadfdskvesgvqlvdfwatwcgsckmiapvleelaadyegkadilkldvdenp
    staakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl