PDB entry 2o6r

View 2o6r on RCSB PDB site
Description: Structural diversity of the hagfish Variable Lymphocyte Receptors B61
Class: immune system
Keywords: Leucine-rich repeat protein, LRR, IMMUNE SYSTEM
Deposited on 2006-12-08, released 2006-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Variable lymphocyte receptor B
  Species: Eptatretus burgeri [TaxId:7764]
  Gene: VLRB
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q4G1L2 (0-176)
  Domains in SCOPe 2.05: d2o6ra_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o6rA (A:)
  cpsrcscsgteircnskgltsvptgipssatrlelesnklqslphgvfdkltqltklsls
  qnqiqslpdgvfdkltkltilylhenklqslpngvfdkltqlkelaldtnqlksvpdgif
  drltslqkiwlhtnpwdcscpridylsrwlnknsqkeqgsakcsgsgkpvrsiicpt