PDB entry 2o5y

View 2o5y on RCSB PDB site
Description: Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab progesterone complex
Class: immune system
Keywords: immunoglobulin, chimeric Fab, antibody engineering, evolution of ligand recognition, IMMUNE SYSTEM
Deposited on 2006-12-06, released 2007-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric antibody Fab 1E9-DB3
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2O5Y (0-End)
  • Chain 'L':
    Compound: chimeric antibody Fab 1E9-DB3
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2O5Y (0-End)
    Domains in SCOPe 2.06: d2o5yl1, d2o5yl2
  • Heterogens: SO4, STR, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2o5yL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfsgsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5yL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfsgsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge