PDB entry 2o5k

View 2o5k on RCSB PDB site
Description: Crystal Structure of GSK3beta in complex with a benzoimidazol inhibitor
Class: Transferase
Keywords: GSK3beta, benzoimidazol inhibitor, Transferase
Deposited on 2006-12-06, released 2007-10-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.24
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o5ka1
  • Heterogens: HBM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o5kA (A:)
    mhhhhhhsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgel
    vaikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyr
    varhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdf
    gsakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgds
    gvdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrll
    eytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipph
    ariqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5kA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari