PDB entry 2o5a

View 2o5a on RCSB PDB site
Description: Crystal structure of Q9KD89 from Bacillus halodurans. Northeast Structural Genomics target BhR21
Class: structural genomics, unknown function
Keywords: bhr21, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-12-05, released 2006-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.251
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH1328 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH1328
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KD89
      • modified residue (26)
    Domains in SCOPe 2.03: d2o5aa1
  • Chain 'B':
    Compound: BH1328 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH1328
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KD89
      • modified residue (26)
    Domains in SCOPe 2.03: d2o5ab_
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o5aA (A:)
    msnqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaq
    eqgieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwgdaptvelegvisleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5aA (A:)
    snqellqlavnavddkkaeqvvalnmkgisldfflichgnsekqvqaiahelkkvaqeqg
    ieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwptveleg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o5aB (B:)
    msnqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaq
    eqgieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwgdaptvelegvisleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5aB (B:)
    nqellqlavnavddkkaeqvvalnmkgisldfflichgnsekqvqaiahelkkvaqeqgi
    eikrlegyeqarwvlidlgdvvvhvfhkderayynleklwptvel