PDB entry 2o56

View 2o56 on RCSB PDB site
Description: Crystal Structure of a Member of the Enolase Superfamily from Salmonella Typhimurium
Class: structural genomics, unknown function
Keywords: DEHYDRATASE, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2006-12-05, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56a1, d2o56a2, d2o56a3
  • Chain 'B':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56b1, d2o56b2, d2o56b3
  • Chain 'C':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56c1, d2o56c2, d2o56c3
  • Chain 'D':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56d1, d2o56d2, d2o56d3
  • Chain 'E':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56e1, d2o56e2, d2o56e3
  • Chain 'F':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56f1, d2o56f2, d2o56f3
  • Chain 'G':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56g1, d2o56g2, d2o56g3
  • Chain 'H':
    Compound: Putative mandelate racemase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM3833
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKY6 (3-398)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d2o56h1, d2o56h2, d2o56h3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o56A (A:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56A (A:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o56B (B:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56B (B:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o56C (C:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56C (C:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o56D (D:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56D (D:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o56E (E:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56E (E:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2o56F (F:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56F (F:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqq
    nlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyye
    epvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevk
    kicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynyl
    pkngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2o56G (G:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56G (G:)
    lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
    gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksr
    ekirtyasqlqfgwgdgsddmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqqn
    lngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyyee
    pvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevkk
    icdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynylp
    kngmyevpelpgigqelteetmkksptitvk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2o56H (H:)
    mslmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmak
    dlsaiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplyk
    mlggksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdr
    hgnwnqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmiee
    lgifyyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictc
    ggitevkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntq
    tckynylpkngmyevpelpgigqelteetmkksptitvkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o56H (H:)
    lmkitsvdiidvakwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiiigmd
    pmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlggksreki
    rtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnwnqqnln
    gpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgifyyeepv
    mplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggitevkkic
    dmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtckynylpkn
    gmyevpelpgigqelteetmkksptitvk