PDB entry 2o52

View 2o52 on RCSB PDB site
Description: Crystal structure of human RAB4B in complex with GDP
Class: protein transport
Keywords: g-protein, rab, GDP, structural genomics, structural genomics consortium, sgc, protein transport
Deposited on 2006-12-05, released 2006-12-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-4B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61018 (22-199)
      • see remark 999 (21)
    Domains in SCOPe 2.04: d2o52a_
  • Chain 'B':
    Compound: Ras-related protein Rab-4B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61018 (22-End)
      • see remark 999 (21)
    Domains in SCOPe 2.04: d2o52b_
  • Heterogens: MG, GDP, BME, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o52A (A:)
    mgsshhhhhhssglvprgsiwsdflfkflvigsagtgkscllhqfienkfkqdsnhtigv
    efgsrvvnvggktvklqiwdtagqerfrsvtrsyyrgaagallvyditsretynslaawl
    tdartlaspnivvilcgnkkdldperevtfleasrfaqenelmfletsaltgenveeafl
    kcartilnkidsgeldperm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o52A (A:)
    sdflfkflvigsagtgkscllhqfievefgsrvvnvggktvklqiwdtagqerfrsvtrs
    yyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkdldperevtflea
    srfaqenelmfletsaltgenveeaflkcartilnkidsgeldperm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o52B (B:)
    mgsshhhhhhssglvprgsiwsdflfkflvigsagtgkscllhqfienkfkqdsnhtigv
    efgsrvvnvggktvklqiwdtagqerfrsvtrsyyrgaagallvyditsretynslaawl
    tdartlaspnivvilcgnkkdldperevtfleasrfaqenelmfletsaltgenveeafl
    kcartilnkidsgeldperm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o52B (B:)
    sdflfkflvigsagtgkscllhqfievefgsrvvnvggktvklqiwdtagqerfrsvtrs
    yyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkdldperevtflea
    srfaqenelmfletsaltgenveeaflkcartilnkid