PDB entry 2o4s

View 2o4s on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease (Q7K) in Complex with Lopinavir
Class: viral protein
Keywords: protease, Viral Protein
Deposited on 2006-12-04, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d2o4sa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d2o4sb_
  • Heterogens: CL, AB1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4sA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4sB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf