PDB entry 2o3l

View 2o3l on RCSB PDB site
Description: Crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2006-12-01, released 2006-12-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:222523]
    Gene: NP_979748.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q734F7 (1-End)
      • leader sequence (0)
      • modified residue (4-6)
      • modified residue (27)
      • modified residue (36)
      • modified residue (38)
    Domains in SCOPe 2.05: d2o3la1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:222523]
    Gene: NP_979748.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q734F7 (1-End)
      • modified residue (4-6)
      • modified residue (27)
      • modified residue (36)
      • modified residue (38)
    Domains in SCOPe 2.05: d2o3lb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o3lA (A:)
    geykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqv
    lditgedvasfadelvanaktyvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3lA (A:)
    geykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqv
    lditgedvasfadelvanaktyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o3lB (B:)
    geykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqv
    lditgedvasfadelvanaktyvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3lB (B:)
    eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl
    ditgedvasfadelvanakty