PDB entry 2o3d

View 2o3d on RCSB PDB site
Description: Structure of human SF2/ASF RNA recognition motif 2 (RRM2)
Class: RNA binding protein
Keywords: RRM domain, RNA BINDING PROTEIN
Deposited on 2006-12-01, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor, arginine/serine-rich 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SFRS1, ASF, SF2, SF2P33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07955 (1-109)
      • expression tag (0)
      • expression tag (110-112)
    Domains in SCOPe 2.06: d2o3da1, d2o3da2, d2o3da3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o3dA (A:)
    maprgrygppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrk
    edmtyavrkldntkfrshegetayirvkvdgprspsygrsrsrsrsrsrsleh