PDB entry 2o2p

View 2o2p on RCSB PDB site
Description: Crystal structure of the C-terminal domain of rat 10'formyltetrahydrofolate dehydrogenase
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, fdh, oxidoreductase
Deposited on 2006-11-30, released 2007-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FTHFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2pa_
  • Chain 'B':
    Compound: Formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FTHFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2pb_
  • Chain 'C':
    Compound: Formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FTHFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2pc_
  • Chain 'D':
    Compound: Formyltetrahydrofolate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FTHFD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2pd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2pA (A:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2pA (A:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o2pB (B:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2pB (B:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o2pC (C:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2pC (C:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o2pD (D:)
    mrgshhhhhttgeddesecvinyvekavnkltlqmpyqlfiggefvdaegsktyntinpt
    dgsvicqvslaqvsdvdkavaaakeafenglwgkinardrgrllyrladvmeqhqeelat
    iealdagavytlalkthvgmsiqtfryfagwcdkiqgatipinqarpnrnltltkkepvg
    vcgivipwnyplmmlswktaaclaagntvvikpaqvtpltalkfaeltlkagipkgvvni
    lpgsgslvgqrlsdhpdvrkigftgstevgkhimkscalsnvkkvslelggkspliifad
    cdlnkavqmgmssvffnkgenciaagrlfveesihnqfvqkvveevekmkignplerdtn
    hgpqnheahlrklveycqrgvkegatlvcggnqvprpgfffqptvftdvedhmyiakees
    fgpimiisrfadgdvdavlsranatefglasgvftrdinkalyvsdklqagtvfintynk
    tdvaapfggfkqsgfgkdlgeaalneylriktvtfey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2pD (D:)
    vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
    vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
    msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
    aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
    kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
    enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
    gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
    sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
    geaalneylriktvtfey