PDB entry 2o2j

View 2o2j on RCSB PDB site
Description: Mycobacterium tuberculosis tryptophan synthase beta chain dimer (apoform)
Class: lyase
Keywords: Amino-acid biosynthesis, Tryptophan biosynthesis, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, LYASE
Deposited on 2006-11-29, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2ja_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2jA (A:)
    mmtdlstpdlprmsaaiaeptshdpdsgghfggpsgwggryvpealmavieevtaayqke
    rvsqdflddldrlqanyagrpsplyeatrlsqhagsariflkredlnhtgshkinnvlgq
    allarrmgktrviaetgagqhgvatatacallgldcviymggidtarqalnvarmrllga
    evvavqtgsktlkdaineafrdwvanadntyycfgtaagphpfptmvrdfqriigmearv
    qiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvgfeaagdgvetgrhaatftag
    spgafhgsfsyllqdedgqtieshsisagldypgvgpehawlkeagrvdyrpitdseamd
    afgllcrmegiipaiesahavagalklgvelgrgavivvnlsgrgdkdvetaakwfgllg
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2jA (A:)
    yvpealmavieevtaayqkervsqdflddldrlqanyagrpsplyeatrlsqhagsarif
    lkredlnhtgshkinnvlgqallarrmgktrviaetgagqhgvatatacallgldcviym
    ggidtarqalnvarmrllgaevvavqtgsktlkdaineafrdwvanadntyycfgtaagp
    hpfptmvrdfqriigmearvqiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvg
    feaagrvdyrpitdseamdafgllcrmegiipaiesahavagalklgvelgrgavivvnl
    sgrgdkdvetaakwf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o2jB (B:)
    mmtdlstpdlprmsaaiaeptshdpdsgghfggpsgwggryvpealmavieevtaayqke
    rvsqdflddldrlqanyagrpsplyeatrlsqhagsariflkredlnhtgshkinnvlgq
    allarrmgktrviaetgagqhgvatatacallgldcviymggidtarqalnvarmrllga
    evvavqtgsktlkdaineafrdwvanadntyycfgtaagphpfptmvrdfqriigmearv
    qiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvgfeaagdgvetgrhaatftag
    spgafhgsfsyllqdedgqtieshsisagldypgvgpehawlkeagrvdyrpitdseamd
    afgllcrmegiipaiesahavagalklgvelgrgavivvnlsgrgdkdvetaakwfgllg
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2jB (B:)
    yvpealmavieevtaayqkervsqdflddldrlqanyagrpsplyeatrlsqhagsarif
    lkredlnhtgshkinnvlgqallarrmgktrviaetgagqhgvatatacallgldcviym
    ggidtarqalnvarmrllgaevvavqtgsktlkdaineafrdwvanadntyycfgtaagp
    hpfptmvrdfqriigmearvqiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvg
    feaagdrvdyrpitdseamdafgllcrmegiipaiesahavagalklgvelgrgavivvn
    lsgrgdkdvetaakwf