PDB entry 2o26

View 2o26 on RCSB PDB site
Description: Structure of a class III RTK signaling assembly
Class: cytokine/signaling protein
Keywords: stem cell factor, receptor tyrosine kinase, class III, receptor-ligand complex, growth factor, cytokine, 4-helix bundle, CYTOKINE-SIGNALING PROTEIN COMPLEX
Deposited on 2006-11-29, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kit ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Kitlg, Kitl, Mgf, Sl, Slf
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20826 (0-138)
      • expression tag (139-143)
    Domains in SCOPe 2.07: d2o26a1, d2o26a2
  • Chain 'B':
    Compound: Kit ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Kitlg, Kitl, Mgf, Sl, Slf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o26b_
  • Chain 'E':
    Compound: Kit ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Kitlg, Kitl, Mgf, Sl, Slf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o26e_
  • Chain 'F':
    Compound: Kit ligand
    Species: Mus musculus [TaxId:10090]
    Gene: Kitlg, Kitl, Mgf, Sl, Slf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o26f_
  • Chain 'U':
    Compound: Mast/stem cell growth factor receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Kit, Sl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05532
      • engineered (121)
  • Chain 'W':
    Compound: Mast/stem cell growth factor receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Kit, Sl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05532
      • engineered (121)
  • Chain 'X':
    Compound: Mast/stem cell growth factor receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Kit, Sl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05532
      • engineered (121)
  • Chain 'Y':
    Compound: Mast/stem cell growth factor receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Kit, Sl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05532
      • engineered (121)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o26A (A:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvlshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o26A (A:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvlshhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o26B (B:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvlshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o26B (B:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o26E (E:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvlshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o26E (E:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2o26F (F:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvlshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o26F (F:)
    icgnpvtdnvkditklvanlpndymitlnyvagmdvlpshcwlrdmviqlslslttlldk
    fsniseglsnysiidklgkivddlvlcmeenapknikespkrpetrsftpeeffsifnrs
    idafkdfmvasdtsdcvls
    

  • Chain 'U':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.