PDB entry 2o1o

View 2o1o on RCSB PDB site
Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with risedronate.
Class: structural genomics, unknown function
Keywords: putative polyprenyl pyrophosphate synthase, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2006-11-29, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: CGD4_2550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o1oa_
  • Chain 'B':
    Compound: Putative farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: CGD4_2550
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o1ob_
  • Heterogens: MG, RIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o1oA (A:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1oA (A:)
    ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
    sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
    ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
    yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
    dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
    naldyliklvkditddslqkvfihlihqiselitn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o1oB (B:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1oB (B:)
    ydytdfinyydkfkvivynvlkklpvieyylncidynvkkgkhirgkilvlisslssays
    nikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaindifflkmls
    lslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiseryfsmvemk
    tsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfndsnaddic
    rfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqrnaldylik
    lvkditddslqkvfihlihqiselitnsrsn