PDB entry 2o1k

View 2o1k on RCSB PDB site
Description: Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein NSP4
Class: viral protein
Keywords: Rotavirus Enterotoxin, Nonstructural protein, NSP4, Tetrameric coiled-coil, virulence, VIRAL PROTEIN
Deposited on 2006-11-29, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural glycoprotein nsp4
    Species: Rotavirus A [TaxId:10923]
    Gene: G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o1ka_
  • Chain 'B':
    Compound: non-structural glycoprotein nsp4
    Species: Rotavirus A [TaxId:10923]
    Gene: G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o1kb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o1kA (A:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1kA (A:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o1kB (B:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvqttgeidmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1kB (B:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq