PDB entry 2o1h

View 2o1h on RCSB PDB site
Description: Naturally occurring mutation of Humna ABO(H) Galactosyltransferase in complex with UDP: GTB/M214T_UDP
Class: Transferase
Keywords: Glycosyltransferase, galactosyltransferase, GTB, blood type subgroup, DXD, Transferase
Deposited on 2006-11-28, released 2007-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABO glycosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70V27 (6-End)
      • cloning artifact (4-5)
      • engineered (156)
    Domains in SCOPe 2.06: d2o1ha1, d2o1ha2
  • Heterogens: HG, MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o1hA (A:)
    aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
    ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevga
    ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdtefrdhvgveiltplfgtlhpsfy
    gssreaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangie
    avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1hA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgrflse
    vdylvcvdvdtefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdf
    yymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspey
    lwdqqllgwpavlrklrftavp