PDB entry 2o1f

View 2o1f on RCSB PDB site
Description: Natural Occuring Mutation of Human ABO(H) galactosyltransferase: GTB/M214R
Class: transferase
Keywords: Glycosytransferase, blood group subtypes. naturally occurring mutation, DXD, GTB, TRANSFERASE
Deposited on 2006-11-28, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABO glycosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70V27 (6-End)
      • cloning artifact (4-5)
      • engineered (156)
    Domains in SCOPe 2.07: d2o1fa1, d2o1fa2
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o1fA (A:)
    aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
    ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevga
    ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdrefrdhvgveiltplfgtlhpsfy
    gssreaftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangie
    avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1fA (A:)
    fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
    aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfl
    sevdylvcvdvdrefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdeg
    dfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlsp
    eylwdqqllgwpavlrklrftavp