PDB entry 2o1e

View 2o1e on RCSB PDB site
Description: Crystal Structure of the Metal-dependent Lipoprotein YcdH from Bacillus subtilis, Northeast Structural Genomics Target SR583
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-11-28, released 2006-12-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YcdH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ycdH, locus_tag=BSU02850
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34966
      • modified residue (30)
      • modified residue (80)
      • modified residue (91)
      • modified residue (108)
      • modified residue (129)
      • modified residue (288)
  • Chain 'B':
    Compound: YcdH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ycdH, locus_tag=BSU02850
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34966
      • modified residue (30)
      • modified residue (80)
      • modified residue (91)
      • modified residue (108)
      • modified residue (129)
      • modified residue (288)
    Domains in SCOPe 2.02: d2o1eb_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o1eB (B:)
    magdpmgnsstkgsadskgdklhvvttfypmyeftkqivkdkgdvdllipssvephdwep
    tpkdianiqdadlfvynseymetwvpsaeksmgqghavfvnaskgidlmegseeeheehd
    hgehehshamdphvwlspvlaqkevknitaqivkqdpdnkeyyeknskeyiaklqdldkl
    yrttakkaekkefitqhtafgylakeyglkqvpiaglspdqepsaaslaklktyakehnv
    kviyfeeiasskvadtlaseigaktevlntleglskeeqdkglgyidimkqnldalkdsl
    lvkslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o1eB (B:)
    klhvvttfypmyeftkqivkdkgdvdllipssvephdweptpkdianiqdadlfvynsey
    metwvpsaeksmgqghavfvnaskgidlmegamdphvwlspvlaqkevknitaqivkqdp
    dnkeyyeknskeyiaklqdldklyrttakkaekkefitqhtafgylakeyglkqvpiagl
    spdqepsaaslaklktyakehnvkviyfeeiasskvadtlaseigaktevlntleglske
    eqdkglgyidimkqnldalkdsll