PDB entry 2o0u

View 2o0u on RCSB PDB site
Description: Crystal structure of human JNK3 complexed with N-{3-cyano-6-[3-(1-piperidinyl)propanoyl]-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl}-1-naphthalenecarboxamide
Class: transferase
Keywords: Kinase fold
Deposited on 2006-11-28, released 2007-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2o0ua1
  • Heterogens: C0M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o0uA (A:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o0uA (A:)
    nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglarfmmtpyvvtryyr
    apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
    ddalqhpyinvwyrehtieewkeliykevmn